Previous Article | Next Article 
Journal of Clinical Microbiology, March 1999, p. 804-806, Vol. 37, No. 3
0095-1137/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
Application of Dried Blood Spot Specimens for
Serologic Subtyping of Human Immunodeficiency Virus Type 1 in
Thailand
P.
Chanbancherd,1
A. E.
Brown,2
R.
Trichavaroj,2
P.
Tienamporn,1
P.
Puthakird,1
N.
Limpairojn,1
T. C.
VanCott,3 and
M. S.
de
Souza2,4,*
Army Institute of
Pathology,1
Armed Forces Research
Institute for Medical Sciences,2 and
Henry M. Jackson Foundation for the Advancement of Military
Medicine,4 Bangkok, Thailand, and
Henry
M. Jackson Foundation for the Advancement of Military Medicine,
Rockville, Maryland3
Received 20 May 1998/Returned for modification 5 October
1998/Accepted 25 November 1998
 |
ABSTRACT |
Dried blood spot (DBS) specimens were assessed as an alternative to
plasma for human immunodeficiency virus type 1 (HIV-1) serotyping by V3
loop peptide enzyme immunoassay. Nested PCR capable of distinguishing
HIV-1 subtypes B and E was used as the reference standard. Ninety-two
percent of DBS samples were typeable as either HIV-1 subtype B or E. Serotype results with DBS and plasma were identical for 254 of 257 specimens. A simple DBS collection method provides a convenient
alternative for conducting HIV-1 serotype surveillance while retaining
sensitivity and specificity.
 |
TEXT |
The human immunodeficiency virus
type 1 (HIV-1) epidemic in Southeast Asia occurred relatively late
compared to that in Europe (4), but the epidemic has been
explosive, and in certain areas multiple subtypes are cocirculating
(11). Thailand was selected by the World Health Organization
as a major site for HIV-1 vaccine trials. One of the problems of the
HIV-1 pandemic is the existence of multiple subtypes or clades, both
within and between geographic regions, which may affect vaccine
strategies. Monitoring of the circulating strain or subtype is also
important in tracking the spread and trend of an HIV-1 epidemic. Dried
blood spot (DBS) specimens have been used in screening antibodies to
measles virus and, more recently, antibodies to HIV-1 (5,
8). In Southeast Asia and many developing countries, the expense
involved in the use of traditional venipuncture and vacutainer serum or
plasma separation tubes, as well as difficulties in transportation to the laboratory and the limited shelf life of serum and plasma outside
of refrigerated storage, can hinder large-scale HIV-1 surveillance.
Subtyping of HIV-1 can be conducted by either genetic or serologic
approaches. Genetic subtyping, while the most definitive method, is
extremely costly and requires relatively elaborate specimen collection,
processing, and technical expertise. Since the V3 loop peptide enzyme
immunoassay (V3-PEIA) was introduced for preliminary HIV-1 subtyping,
success has been reported with HIV-1 subtypes A, B, C, and E. In
Thailand, two clades of HIV-1, subtypes B and E, are currently
circulating. V3-PEIA has been used in that country for serotyping
antibody responses to these subtypes with high specificity (95 to
100%) and sensitivity (85 to 95%) (9).
In this study, V3 serotyping of antibodies eluted from DBS was compared
with that of plasma antibodies, and both methods were compared with
PCR-based genotyping of HIV DNA from the same individuals. Three
milliliters of whole blood was collected from 257 HIV-1-seropositive and 8 HIV-1-seronegative subjects, based on screening with a gel particle agglutination assay (Serodia-HIV; Fujirebio, Tokyo, Japan) and
confirmation by Western blotting (Bio-Rad, Hercules, Calif.). Blood was
collected with potassium-EDTA vacutainer tubes (Becton-Dickinson, Franklin Lakes, N.J.), divided into three aliquots, and treated as
follows. Duplicates of 5 and 20 µl of whole blood were spotted onto
the circled areas of standard filter paper (no. 903; Schleicher and
Schuell, Keene, N.H.). Samples were air dried at room temperature (25 to 35°C) for a minimum of 18 h and placed in individual Ziploc bags and stored at room temperature in the dark until testing. Approximately 1 ml of blood was centrifuged at 800 × g
for 10 min; the plasma layer was removed and stored at
20°C until
testing. The remaining blood (approximately 1 ml) was treated with 3 ml of FACScan lysing solution (Becton-Dickinson) for 10 min. Twelve milliliters of phosphate-buffered saline (PBS) was added; the suspension was centrifuged at 600 × g for 10 min, and
the supernatant was discarded. This procedure was repeated twice. The
pellet was frozen at
70°C until testing by nested PCR. To extend
the DBS collection technique to a distant laboratory, an additional 30 samples were collected and processed as described for DBS and plasma at
a laboratory in northern Thailand and shipped at room temperature (for
DBS) or in ice packs (for plasma) by overnight bus to the serotyping
laboratory. PCR was not performed on these specimens due to blood
volume limitations.
A 5-mm hole punch was used to cut out filter disc DBS (discs were
always completely saturated with blood with the 20-µl spot but not
with the 5-µl spot), and individual discs were placed directly in 1 ml of specimen diluent (PBS [pH 7.4], 5% dry nonfat milk, and 0.1%
Tween). Antibody was eluted overnight at 4°C. The eluate was then
tested in parallel with 10 µl of plasma (assuming a 50% plasma yield
from whole blood) from the same original specimen. An antigen-limiting
V3-PEIA, as previously described (6), was modified in that
each specimen was tested at a single dilution (1:100) against a range
of peptide concentrations: 0.5, 0.05, and 0.005 µg/ml. The
peptides used were V3-CM237
(CTRTPNNNTRKSIHLGPGKAWYTTGQIIGDIRQAH) and V3-CM242
(CTRPSNNTRTSITIGPGQVFYRTGDIIGDIRKAY), which have been
previously shown to distinguish HIV-1 subtypes B and E in Thai subjects
(1, 13). The cutoff value of the assay was determined by the
equation 2 × (mean of pooled HIV-1-seronegative samples + standard deviation). A fourfold or higher ratio of the optical density
obtained at the same peptide concentration from one peptide relative to
the other was used to assign the HIV-1 subtype. Eluted antibodies or
plasma demonstrating reactivity to both peptides but at less than a
fourfold differential were classified as dually reactive. Specimens
having an optical density of equal to or less than the cutoff value for
both peptides were classified as nonreactive.
Cell pellets were thawed and subjected to proteinase K digestion, and
0.5 to 1 µg of peripheral blood mononuclear cell (PBMC) DNA was
assayed by nested PCR with primers from the env gp41 region, as previously described (1), and universal first-round
primers and second-round primers capable of differentiating HIV-1
genotypes B and E. Amplification products were analyzed by
electrophoresis on ethidium bromide-stained 1.5% agarose gels.
Negative controls included PBMC DNA from HIV-1-seronegative donors
amplified concurrently with the patient samples. Positive controls were
PBMC DNA obtained from HIV-1-infected Thai subjects of known genotype,
B or E. Samples which failed to amplify were scored as unamplifiable.
HIV-1 subtyping was successful with 243 (95%) plasma samples and 240 (93%) DBS samples, of the 257 specimens from HIV-1-infected subjects
(Table 1). Most specimens were found to
be HIV-1 subtype E. With plasma, 226 were typed as E, 12 as B, and 5 as
dually reactive; with DBS, 225 were typed as E, 11 as B, and 4 as
dually reactive. Three specimens were typeable by plasma but not DBS (one each B, E, and B/E). Both plasma and DBS samples from 14 subjects
were nonreactive by peptide serology. All of the eight HIV-1-seronegative controls were nonreactive by both specimen collection methods. Use of a 5-µl volume of blood for DBS decreased the serotyping sensitivity of DBS by 12% (211 and 240 specimens were
subtyped with 5 and 20 µl of DBS, respectively). Sensitivities for
both serotypes were decreased (from 11 to 8 for B and from 225 to 199 for E), with the number of dual reactors unchanged. The additional 30 samples transported by overnight bus from the rural laboratory were
obtained from 27 HIV-seropositive and 3 HIV-seronegative subjects. All
samples from the seropositive subjects were subtyped as HIV subtype E
by both the DBS and plasma methods, with the three HIV-seronegative
samples being nonreactive for both DBS and plasma specimen collection.
PCR resulted in genotyping of 207 (81%) of the 257 specimens (Table
2). Twelve were typed as B, 195 were
typed as E, 3 were amplified but could not be typed, and 47 failed to
amplify. Subtype E was the predominant HIV-1 clade in the study
population, a finding consistent with previous reports (11).
Interestingly, PCR genotyping amplified both B and E products in two of
the specimens which were serotyped as dual reactors by both DBS and
plasma. This may represent genetic variants of HIV-1, specimen
contamination, or subjects dually infected with both subtypes, as
previously described (1). The rate of detection of HIV-1 by
PCR was lower in this study than previously reported (6).
The PCR method was unchanged, but sensitivity may have been affected by
specimen preparation. Whole blood, rather than isolated PBMC, was used
for DNA extraction in this study, and the porphyrin moiety of heme from
contaminating erythrocytes has been shown to inhibit PCR
(7). Alternatively, the use of EDTA tubes for venipuncture
may have chelated magnesium necessary for PCR. This study assessed
simplified diagnostic methods; hence, the nucleic acid extract was not
subjected to any purification procedures. A direct comparison of HIV
genotyping by nested PCR was made with EDTA-collected whole blood from
9 HIV-seropositive subjects. Two milliliters of blood was divided
equally, and PBMC were prepared by either standard Ficoll-Hypaque
separation (6) or the lysing method described in the present
study. HIV-specific products were amplified with DNA obtained from
eight of nine subjects (five were subtype E and three were subtype B)
by the Ficoll technique and from five of nine subjects by the
erythrocyte lysis procedure, implying that erythrocyte contamination
was the major cause of PCR inhibition.
View this table:
[in this window]
[in a new window]
|
TABLE 2.
Comparison of results of specimen subtyping based on
genotyping of proviral DNA by PCR and serotyping with DBS (20 µl)
and V3-PEIA
|
|
No samples were classified as one subtype by serology and another by
PCR, although one dually amplified specimen by PCR was subtyped as
HIV-1 clade E by peptide serotyping. With sera and plasma, it has been
reported that HIV-1 serotype E shows high concordance with genetic
subtyping (82 to 96%), while subtype B (Thailand) shows poor
concordance (0 to 50%) with genetic typing, as assessed by three
independent laboratories (2).
HIV-1 serotyping is an important epidemiological tool in Thailand,
where two viral subtypes are currently circulating (11). These results show that DBS provides a reliable alternative to plasma
for such testing. The current study used 20 µl of whole blood, but
one blood drop corresponds to approximately 15 to 20 µl of whole
blood, with a finger prick yielding approximately 10 to 20 drops
(3). Our study demonstrates that DBS specimen collection
could be used as a field-applicable epidemiological tool with more
sophisticated genetic techniques used on dually reactive or nontypeable
specimens from known HIV-positive subjects. The method has the great
advantage of not requiring elaborate serum or plasma collection
equipment, and DBS are easy to store and transport, providing an
excellent option for HIV-1 serotyping in pediatric populations. Most
importantly, the reduced use of glassware in DBS collection decreases
the occupational exposure of health care workers to blood-borne pathogens.
 |
ACKNOWLEDGMENTS |
We thank Deborah Birx for ongoing support in this work and Jean K. Carr for helpful discussions. We also thank George Watt and Pacharee
Kantipong for providing specimens from Chiang Rai, Thailand.
Support for this work was provided by the Medical Research and Materiel
Command, U.S. Army, and the Royal Thai Army. Additional support was
provided through Cooperative Agreement no. DAMD17-93-V-3004 between the
U.S. Army Medical Research and Materiel Command and the Henry M. Jackson Foundation for the Advancement of Military Medicine.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: Henry M. Jackson
Foundation for the Advancement of Military Medicine, AFRIMS, 315/6 Rajvithi Road, Bangkok 10400, Thailand. Phone: 66-2-644-4888, ext.
1504. Fax: 66-2-644-4824. E-mail: mdesouza{at}hiv.hjf.org.
 |
REFERENCES |
| 1.
|
Artenstein, A. W.,
T. C. VanCott,
J. Mascola,
J. K. Carr,
P. A. Hegerich,
J. Gaywee,
E. Sanders-Buell,
M. L. Robb,
D. E. Dayhoff,
S. Thitivichianlert,
S. Nitayaphan,
J. G. McNeil,
D. L. Birx,
R. A. Michael,
D. S. Burke, and F. E. McCutchan.
1995.
Dual infection with human immunodeficiency virus type 1 of distinct envelope subtypes in humans.
J. Infect. Dis.
171:805-810[Medline].
|
| 2.
|
Cheingsong-Popov, R.,
S. Osmanov,
C.-P. Pau,
G. Schochetman,
F. Barin,
H. Holmes,
G. Francis,
H. Ruppach,
U. Dietrich,
S. Lister,
J. Weber, and the UNAIDS Network for HIV-1 Isolation and Characterization.
1998.
Serotyping of HIV type 1 infections: definition, relationship to viral genetic subtypes, and assay evaluation.
AIDS Res. Hum. Retroviruses
14:311-318[Medline].
|
| 3.
|
Evengard, B.,
E. Linder, and P. Lundbergh.
1988.
Standardization of a filter-paper technique for blood sampling.
Ann. Trop. Med. Parasitol.
82:295-303[Medline].
|
| 4.
|
Expert Group of the Joint United Nations Programme on HIV/AIDS.
1997.
Implications of HIV variability for transmission: scientific and policy issues.
AIDS
11:UNAIDS1-UNAIDS13[Medline].
|
| 5.
|
Farzadegan, H.,
T. Quinn, and B. F. Polk.
1987.
Detecting antibodies to human immunodeficiency virus in dried blood on filter paper.
J. Infect. Dis.
155:1073-1074[Medline].
|
| 6.
|
Gaywee, J.,
A. W. Artenstein,
T. C. VanCott,
R. Trichavaroj,
A. Sukchamnong,
P. Amlee,
M. S. de Souza,
F. E. McCutchan,
J. K. Carr,
L. E. Markowitz,
R. Michael, and S. Nitayaphan.
1996.
Correlation of genetic and serologic approaches to HIV-1 subtyping in Thailand.
J. Acquired Immune Defic. Syndr.
13:392-396.
|
| 7.
|
Higuchi, R.
1989.
Rapid, efficient DNA extraction for PCR from cells or blood.
Amplifications
2:1-3.
|
| 8.
|
Lindhardt, B. O.,
C. Bygbjerg,
K. Ulrich,
H. D. Petersen,
I. Lausen, and B. Frederiksen.
1987.
Detection of antibodies to human immunodeficiency virus (HIV) in eluates from whole blood impregnated filter paper discs.
J. Virol. Methods.
18:73-77[Medline].
|
| 9.
|
Louisirirotchanakul, S.,
A. Bobkov,
N. Shaffer,
T. D. Mastro,
C. Wasi,
J. Weber, and R. Cheingsong-Popov.
1997.
Sequence analysis of an HIV type 1 env subtype E isolate from Thailand with discordant V3-loop serotyping.
AIDS Res. Hum. Retroviruses
13:807-809[Medline].
|
| 10.
|
Pau, C.-P.,
M. Kai,
D. L. Holloman-Candal,
C.-C. Luo,
M. L. Kalish,
G. Schochetman,
B. Byers,
J. R. George, and the WHO Network for HIV Isolation and Characterization.
1994.
Antigenic variation and serotyping of HIV type 1 from four World Health Organization-sponsored HIV vaccine sites.
AIDS Res. Hum. Retroviruses
10:1369-1377[Medline].
|
| 11.
|
Subbarao, S.,
K. Limpakarnjanarat,
T. D. Mastro,
J. Bhumisawadi,
P. Warachit,
C. Jayavasu,
N. L. Young,
C.-C. Luo,
N. Shaffer,
M. L. Kalish, and G. Schochetman.
1998.
HIV type 1 in Thailand, 1994-1995: persistence of two subtypes of low genetic diversity.
AIDS Res. Hum. Retroviruses
14:319-327[Medline].
|
| 12.
|
Sutthent, R.,
S. Foongladda,
S. Likanonskul,
S. Tunsupasawasdeekul,
A. Roongpisuthipong,
S. Chearskul,
S. Raktham,
S. Louisirirotchanakul, and C. Wasi.
1996.
Detection of HIV-1 proviral DNA by polymerase chain reaction: a preliminary study in Bangkok.
J. Med. Assoc. Thail.
79:140-148.
|
| 13.
|
VanCott, T. C.,
F. R. Bethke,
A. W. Artenstein,
F. E. McCutchan,
J. G. McNeil,
J. R. Mascola,
R. R. Redfield, and D. L. Birx.
1994.
Serotyping international HIV-1 isolates by V3 peptides and whole gp160 proteins using BIAcore.
Methods Companion Methods Enzymol.
6:188-198.
|
Journal of Clinical Microbiology, March 1999, p. 804-806, Vol. 37, No. 3
0095-1137/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Tetali, S., Lee, E. M., Kaplan, M. H., Romano, J. W., Ginocchio, C. C.
(2001). Chemokine Receptor CCR5 {Delta}32 Genetic Analysis Using Multiple Specimen Types and the NucliSens Basic Kit. CVI
8: 965-971
[Abstract]
[Full Text]