Previous Article | Next Article 
Journal of Clinical Microbiology, February 2000, p. 773-780, Vol. 38, No. 2
0095-1137/00/$04.00+0
Analysis of Genetic Variability within the
Immunodominant Epitopes of Envelope gp41 from Human
Immunodeficiency Virus Type 1 (HIV-1) Group M and Its Impact on HIV-1
Antibody Detection
Jonathan
Dorn,1
Silvina
Masciotra,1
Chunfu
Yang,1
Robert
Downing,2
Benon
Biryahwaho,2
Timothy D.
Mastro,3
John
Nkengasong,4
Danuta
Pieniazek,5
Mark A.
Rayfield,5
Dale J.
Hu,6 and
Renu B.
Lal1,*
HIV Immunology and Diagnostics
Branch,1 and HIV and Retroviruses
Diseases Branch,5 Division of AIDS, STD, and TB
Laboratory Research, National Center for Infectious Diseases, and
International Activities Branch, Division of HIV/AIDS
Prevention-Surveillance and Epidemiology Branch, National Center for
HIV, STD and TB Prevention,6 Centers for
Disease Control and Prevntion, Atlanta, Georgia 30333; Uganda
Virus Research Institute, Entebbe, Uganda2;
HIV/AIDS Collaboration, Nonthaburi,
Thailand3; and Projet RETRO-CI, Abidjan,
Côte d'Ivoire4
Received 26 August 1999/Returned for modification 11 October
1999/Accepted 11 November 1999
 |
ABSTRACT |
The serodiagnosis of human immunodeficiency virus type 1 (HIV-1)
infection primarily relies on the detection of antibodies, most of which are directed against the immunodominant regions (IDR) of
HIV-1 structural proteins. Among these, the N-terminal region of gp41
contains cluster I (amino acids [aa] 580 to 623), comprising the
cytotoxic T-lymphocyte epitope (AVERYLKDQQLL) and the cysteine loop
(CSGKLIC), and cluster II (aa 646 to 682), comprising an ectodomain
region (ELDKWA). To delineate the epitope diversity within clusters I
and II and to determine whether the diversity affects serologic
detection by U.S. Food and Drug Administration (FDA)-licensed
enzyme immunoassay (EIA) kits, gp41 Env sequences from 247 seropositive
persons infected with HIV-1 group M, subtypes A (n = 42), B (n = 62), B' (n = 13), C
(n = 38), D (n = 41), E (n = 18), F (n = 27), and G
(n = 6), and 6 HIV-1-infected but persistently
seronegative (HIPS) persons were analyzed. While all IDR were highly
conserved among both seropositive and HIPS persons, minor amino acid
substitutions (<20% for any one residue, mostly conservative) were
observed for all subtypes, except for B', in comparison with the
consensus sequence for each subtype. Most importantly, none of the
observed substitutions among the group M plasma specimens affected
antibody detection, since all specimens (n = 152)
tested positive with all five FDA-licensed EIA kits.
Furthermore, all specimens reacted with a group M consensus gp41 peptide
(WGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICTTAVPWNASW), and high degrees
of cross-reactivity (>80%) were observed with an HIV-1
group N peptide, an HIV-1 group O peptide, and a peptide derived from the homologous region of gp41 from simian
immunodeficiency virus from chimpanzee (SIVcpz). Taken together, these
data indicate that the minor substitutions observed within the IDR of
gp41 of HIV-1 group M subtypes do not affect antibody recognition and that all HIV-1-seropositive specimens containing the observed substitutions react with the FDA-licensed EIA kits regardless of viral
genotype and geographic origin.
 |
INTRODUCTION |
Human immunodeficiency virus type 1 (HIV-1) is the etiologic agent responsible for the pandemic of AIDS
(9, 14). Worldwide, it is estimated that more than 30 million persons are infected with HIV-1 and that 16,000 new cases of
HIV-1 infection occur every day. HIV-1 is characterized by an unusually
high degree of genetic variability in vivo (14). Analysis of
HIV-1 env genes of virus strains from different geographic
regions has revealed that HIV-1 can be divided into three main groups:
M (major), O (outlier), and N (new) (9, 14, 24). HIV-1 group
M has been further subdivided into genetically equidistant clusters of
HIV-1 env genes, comprising subtypes A to J (14).
Except during the initial acute phase of infection, referred to as the
"window period," which occurs before a persistent antibody response
has been established (2, 3), most infected persons produce
HIV-1-specific antibodies that can be detected by standard diagnostic
tests (2). In addition, several reported patients exhibit a
history of HIV-1 seronegativity despite demonstrating clinical AIDS
(1, 5, 25). Loss of HIV-1 antibody production concomitant
with HIV-1 disease progression has occurred in a small percentage of
infected individuals (1).
Since most serologic assays rely on antibody responses to the
structural proteins of HIV-1, genetic variability within the envelope
protein, particularly gp41, can have an impact on serologic detection
(8, 18). Encoded by the env genes of HIV-1 are two heavily glycosylated proteins, the outer membrane gp120 and the
carboxyl-terminal transmembrane gp41 (10, 14). gp41 has many
functional domains, including the immunodominant region (IDR) in the
amino-terminal portion (10). The IDR of gp41 contains cluster I (amino acids [aa] 580 to 623), comprising both the CTL epitope (aa 591 to 602; AVERYLKDQQLL) and the cysteine loop (aa 607 to
613; CSGKLIC), and cluster II (aa 646 to 682), comprising an ectodomain
region (aa 671 to 676; ELDKWA). The CTL epitope, cysteine loop, and
ectodomain are considered part of the IDR since >99% of
HIV-1-infected individuals produce antibodies directed against them
(8, 10, 16, 18).
The envelope protein of HIV-1 has an unusually high degree of sequence
variability among all subtypes of HIV-1 group M viruses, as well as
among group O and group N viruses (14). Since most serologic
assays are based on the immunogenicity of gp41, specific mutations in
the IDRs of gp41 can potentially alter antibody binding in serologic
assays. In this study, we analyzed gp41 sequences from 247 seropositive
HIV-1 group M-infected individuals, representing subtypes A to G, and 6 seronegative persons with AIDS to delineate the epitope diversity. In
addition, plasma from individuals infected with HIV-1 strains
exhibiting amino acid substitutions within the IDR of gp41 were tested
with U.S. Food and Drug Administration (FDA)-licensed enzyme
immunoassay (EIA) kits as well as a gp41 group M consensus
peptide-based EIA to determine whether the observed substitution(s) had
an impact on serologic detection.
 |
MATERIALS AND METHODS |
Study subjects.
Samples tested in the present study are part
of various ongoing studies throughout the world and were selected based
on their HIV-1-positive results with various EIA kits. Plasma specimens from 247 HIV-1 group M-infected individuals were selected from Argentina (20 subtype B and 27 subtype F), Cameroon (11 subtype A),
Canada (1 subtype B), China (5 subtype B and 1 subtype B'), Egypt (1 subtype B), Ghana (6 subtype A and 5 subtype G), India (3 subtype C),
Ivory Coast (7 subtype A, 1 subtype D, and 1 subtype G), Mexico (8 subtype B), Mozambique (5 subtype C), South Africa (1 subtype B and 4 subtype C), Thailand (12 subtype B' and 18 subtype E), Uganda (17 subtype A, 14 subtype C, and 40 subtype D), the United States (1 subtype A and 26 subtype B), and Zimbabwe (12 subtype C). In addition,
six specimens from HIV-1-infected but persistently seronegative (HIPS)
persons from the United States (25) were also included. All
specimens were subtyped by phylogenetic analysis of the Env region
(19, 27).
PCR amplification and sequence analysis.
We recently
developed an assay based on a conserved sequence within the gp41 region
which is highly sensitive for amplification of viral RNA from plasma of
HIV-1-positive specimens representing different subtypes of HIV-1 group
M (19, 27). Following amplification, DNA from the nested PCR
was cycle sequenced (60 ng of DNA per sequencing reaction) with an ABI
PRISM Dye Terminator Cycle Sequencing Ready Reaction Kit according to
the manufacturer's protocol (Perkin-Elmer, Foster City, Calif.) and
with the nested primers gp46F2 and gp47R2 (27). Sequencing
reactions were run in an automated DNA sequencer (model 373; Applied
Biosystems, Foster City, Calif.). Sequences were then translated and
aligned using DNASIS v.2.1 (Hitachi Software, San Bruno, Calif.). The
consensus sequence for each subtype was obtained from the 1997 HIV-1
Molecular Immunology Database (Los Alamos National Laboratory, Los
Alamos, N.Mex.).
HIV-1 antibody detection.
Plasma samples were tested using
the following FDA-licensed EIA kits: Abbott Laboratories (Chicago,
Ill.) HIVAB HIV-1 EIA and HIVAB HIV-1/HIV-2 (recombinant DNA EIA),
Genetic Systems (Redmond, Wash.) LAV EIA and HIV-1/HIV-2 Peptide EIA,
and Organon Teknika (Durham, N.C.) Vironostika HIV Microelisa System.
All assays were performed according to the manufacturers' protocols.
The synthetic peptides derived from the gp41 region representing the
consensus sequence for HIV-1 group M as well as the homologous regions
for HIV-1 group O and group N and SIVcpzGAB were synthesized by
9-fluorenylmethoxycarbonyl chemistry. The 44-mer peptides representing consensus group M (aa 580 to 623;
(WGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICTTAVPWNASW), consensus group O
(WGIRQLRARLLALETLIQNQQLLNLWGCKGKLVCYTSVKWNRTW), group N
(WGIKQLQAKVLAIERYLRDQQILGSLGCSGKTICYTTVPWNETW),
and SIVcpzGAB (WGVKQLQARLLAVERYLQDQQILGLWGCSGKAVCYTTVPWNNSW)
were used to develop a peptide-based assay in a manner
similar to that described previously (23). Briefly,
polyvinyl plates (Immulon II; Dynatech Laboratories, Inc., Alexandria,
Va.) were coated with 5 µg of synthetic peptide per ml (100 µl/well) in 0.01 M carbonate buffer (pH 9.6) and incubated overnight
at 4°C. The plates were washed six times with phosphate-buffered saline containing 0.05% Tween 20; excess reactive sites were blocked by the addition of 5% bovine serum albumin in phosphate-buffered saline-0.05% Tween 20. This step was followed by the addition of a
1:100 dilution of each test serum. The plates were incubated overnight at 4°C. After six more washes, Fc-specific, alkaline phosphatase-conjugated goat antibody to human immunoglobulin G (Sigma,
St. Louis, Mo.) was added, and the plates were left at room temperature
for 2 h. This step was followed by the addition of 1 mg of
p-nitrophenyl phosphate substrate (Sigma) per ml (50 µl/well). The plates were read after 1 h with an EIA reader (SLT Lab Instruments, Ronkonkome, N.Y.) at 405 nm. The cutoff values were
calculated by adding 0.1 to the mean optical densities plus 3 standard
deviations of normal control sera in respective peptide-based assays.
 |
RESULTS |
Sequence analysis of gp41 cluster I and cluster II.
To
determine the sequence variability within the immunodominant regions of
the gp41 protein, cluster I (aa 580 to 623) and cluster II (aa 646 to
682) sequences derived from the 247 HIV-1 group M-infected individuals
and representing subtypes A (n = 42), B (n = 62), B' (n = 13), C (n = 38), D
(n = 41), E (n = 18), F (n = 27), and G (n = 6) were aligned (Fig.
1 and
2). Within cluster I,
there were minor amino acid substitutions (<20% for any one residue,
mostly conservative) at positions 587, 589, 592, 594, 597, 604, 610, 614, 616, and 621 compared to the consensus sequence for each subtype.
Analysis of the CTL epitope and the cysteine loop revealed minor amino
acid substitutions in all subtypes except B'. For the CTL epitope,
these included V592
L or I (55%) and
R597
K, Q, or A (67%) in subtype A,
K587
R, Q, G, or H (39%) in subtype B,
R594
S, N, or K (64%) and K597
R or Q
(41%) in subtype D, F601
Q or T (22%) in subtype E,
K597
G, R, Q, and S (37%) in subtype F, and
V592
L (33%) and K597
R (33%) in subtype
G. For the cysteine loop, a K610
R or T (34%)
substitution in subtype D was observed. Furthermore, a number of
samples exhibited amino acid substitutions in both the CTL epitope and
the cysteine loop (Fig. 1). While the critical positions of the
glycosylation site [N-X-(S,T)] of cluster I were highly conserved
(>95%) in all subtypes, significant amino acid substitutions were
observed at noncritical position 621 (X) for subtypes B (55%), B'
(31%), C (21%), E (22%), and G (67%) (Fig. 1). Minor amino acid
changes (<5%) were observed at critical position N620,
S622, or T622.

View larger version (27K):
[in this window]
[in a new window]
|
FIG. 1.
Analysis of sequence divergence in gp41 cluster I (aa
580 to 623) from 247 HIV-1 group M subtype A to G specimens. The CTL
epitope (aa 591 to 602), the cysteine loop (aa 607 to 613), and the
glycosylation site (aa 620 to 622) are shaded. The left column shows
the number of specimens for each subtype examined. The numbers of
specimens with amino acid substitutions are shown for each subtype;
dashes represent conserved amino acids in all specimens. *, specimens
from six HIPS AIDS patients infected with subtype B virus.
|
|

View larger version (32K):
[in this window]
[in a new window]
|
FIG. 2.
Analysis of sequence divergence in gp41 cluster II
(aa 646 to 682) from 247 HIV-1 group M subtype A to G specimens. The
glycosylation site (aa 646 to 648) and the ectodomain (aa 671 to 676)
are shaded. The left column shows the number of specimens for each
subtype examined. The numbers of specimens with amino acid
substitutions are shown for each subtype; dashes represent conserved
amino acids in all specimens. *, specimens from six HIPS AIDS
patients infected with subtype B virus.
|
|
A similar analysis of gp41 cluster II sequences (aa 646 to 682) from
group M-infected individuals (subtypes A to G) also revealed
minor
substitutions (Fig.
2). Overall, minor substitutions occurred
at
positions 649, 650, 653, 655, 656, 657, 660, 664, 667, 668,
671, 674,
676, 677, and 680. Analysis of the ectodomain revealed
minor
substitutions, including E
671
A, G, D, or S (24%) in
subtype B, K
674
S or R (66%) and Q
676
K,
N, or D (50%) in subtype C, and Q
671
K, E, A, or P
(34%) and K
674
Q or N (22%) in subtype D. Furthermore,
a number of samples exhibited
multiple amino acid substitutions within
the ectodomain (Fig.
2). Unlike the glycosylation site within cluster
I, the glycosylation
site within cluster II did not exhibit significant
amino acid
substitutions.
We and others have recently described several seronegative AIDS
patients who are HIV-1 infected (
1,
5,
25). Analysis
of gp41
sequences from six of these HIPS persons (all infected
with subtype B
virus) revealed minor amino acid substitution in
both cluster I (Fig.
1) and cluster II (Fig.
2). Specifically,
the cysteine loop region
within cluster I was conserved; however,
K
597
Q or G in
the CTL epitope and E
671
A or K in the ectodomain were
observed in half of the
specimens.
Effect of amino acid substitutions on serologic detection.
To
determine the effect of the amino acid substitutions on serologic
detection, a subset of 152 samples (10 subtype A, 29 subtype B, 13 subtype B', 25 subtype C, 24 subtype D, 18 subtype E, 27 subtype F, and
6 subtype G) representing the cluster I and cluster II sequences with
or without amino acid substitutions were tested using the five
FDA-licensed EIA kits. All specimens, regardless of single or multiple
substitutions in either cluster, were found serologically positive when
tested with these kits (Fig.
3). Therefore, the minor
amino acid substitutions within clusters I and II had no impact on
antibody detection in serum from HIV-1-positive individuals.


View larger version (3423K):
[in this window]
[in a new window]
|
FIG. 3.
Reactivity of HIV-1 group M plasma specimens with five
FDA-licensed EIA kits (last five columns, from left to right: Abbott
HIVAB HIV-1 EIA, Abbott HIVAB HIV-1/HIV-2, Genetic Systems LAV EIA,
Genetic Systems HIV-1/HIV-2 Peptide EIA, and Organon Teknika
Vironostika HIV Microelisa System). Representative specimens
(n = 152) with and without amino acid substitutions in
the cluster I and cluster II regions were tested with the EIA kits.
Specific mutations within the CTL epitope, the cysteine loop, and the
ectodomain are shown for each subtype. nt, not tested.
|
|
Since most commercial assays are based on multiple antigens, such as
viral lysates, synthetic peptides, and/or recombinant
proteins, we
determined whether any of the amino acid substitutions
would abrogate
direct binding to a gp41 consensus peptide. A peptide-based
assay
containing a 44-mer consensus sequence for HIV-1 group M,
subtypes A to
H, was used to detect antibodies in specimens with
and without
mutations. Of the 131 samples (10 subtype A, 21 subtype
B, 13 subtype
B', 20 subtype C, 21 subtype D, 15 subtype E, 25
subtype F, and 6 subtype G) tested with the gp41 group M peptide-based
EIA, all were
reactive with the gp41 consensus peptide, regardless
of amino acid
substitution or HIV-1 subtype (Fig.
4).

View larger version (73K):
[in this window]
[in a new window]
|
FIG. 4.
Detection of gp41-specific antibodies using synthetic
peptides comprising cluster I sequences (aa 580 to 623). The percent
reactivities of HIV-1 group M plasma specimens are shown for consensus
group M peptide ( ) and group O peptide ( ) or homologous regions
of group N peptide ( ) and SIVcpz peptide ( ). The 44-mer peptides
representing consensus sequences include group M
(WGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICTTAVPWNASW), group O
(WGIRQLRARLLALETLIQNQQLLNLWGCKGKLVCYTSVKWNRTW), group N
(WGIKQLQAKVLAIERYLRDQQILGSLGCSGKTICYTTVPWNETW), and SIVcpz
(WGVKQLQARLLAVERYLQDQQILGLWGCSGKAVCYTTVPWNNSW). All 131 samples, regardless of substitution in gp41 regions, reacted with the
gp41 group M peptide-based EIA, and a high degree of cross-reactivity
to HIV-1 group O and N peptides and in SIVcpz peptide was observed.
|
|
None of the HIPS specimens had detectable antibody in any of the
FDA-licensed EIA kits or gp41 peptide-based assay (data not
shown).
Cross-reactive gp41 antibodies for HIV-1 groups M, N, and O.
Recent identification of a new group of HIV-1, group N, as well as
research indicating the origin of HIV-1 in Pan troglodytes troglodytes (6, 24), prompted us to examine the
cross-reactivity of group M sera with the homologous regions of group
O, group N, and SIVcpz gp41 peptides. Of the 131 HIV-1 group M
specimens, 120 (91.6%; 9 subtype A, 19 subtype B, 12 subtype B', 20 subtype C, 19 subtype D, 15 subtype E, 20 subtype F, and 6 subtype G) reacted with the group N peptide and 123 (93.9%; 9 subtype A, 20 subtype B, 11 subtype B', 20 subtype C, 20 subtype D, 15 subtype E, 22 subtype F, and 6 subtype G) reacted with the SIVcpz peptide, suggesting
a high degree of cross-reactivity (Fig. 4). Further, 110 of the 131 group M specimens (84.0%; 9 subtype A, 16 subtype B, 12 subtype B', 20 subtype C, 11 subtype D, 13 subtype E, 23 subtype F, and 6 subtype G)
also reacted with the highly divergent group O peptide (Fig. 4).
 |
DISCUSSION |
The genetic diversity within the HIV-1 env gene and
within the IDRs of structural proteins directly affects antibody
detection. Currently, efforts to improve HIV-1 serologic detection
focus on the addition of recombinant and/or synthetic peptides
representing the IDRs within the gp41 region of HIV-1 to diagnostic EIA
kits. The present study indicates that some variability exists within the IDRs of gp41; however, none of the minor substitutions reported had
an impact on serologic detection by five currently approved, FDA-licensed EIA kits or by a gp41 group M peptide-based EIA.
Previous studies have shown that natural sequence variation within
cluster I can lead to escape from immune detection, indicating that
sequence variation within HIV-1 may contribute to the evolution of
viral variants that are no longer recognized by the host immune response (8, 18, 26). Specifically, the cysteine loop, containing an intermolecular disulfide bond, represents the most immunogenic region of gp41 (10). Furthermore, the
elimination of loop formation by substitution of S for C at the amino
or carboxyl terminus of the peptide abrogates the binding of human
monoclonal antibodies, suggesting that the disulfide bridge is
necessary to maintain the three-dimensional structure required for
antibody recognition (26). Our study demonstrates that the
CxxxxxxC domain was conserved in all specimens, regardless of specimen
genotype and geographic origin, further confirming the functional
importance of this conserved epitope. An L611
H
substitution within the cysteine loop has also been shown to affect
antibody reactivity (8). However, the 25 specimens in this
study (2 subtype B, 22 subtype D and 1 subtype F) containing an
L611
H substitution were reactive against whole viral
lysates as well as in a gp41 peptide-based assay. While the
investigators in the previous study had used a small peptide for
epitope delineation (8), we have used a longer peptide that
also covers the other immunodominant region and hence may have masked
the antibody response specifically directed against only the cysteine
loop structure. A recent study has shown that a lack of antibody
response to this epitope results in rapid disease progression in
infants (4).
Another important aspect of this study was the delineation of sequence
variability in the CTL epitope of gp41. The CTL epitope, AVERYLKDQQLL,
is restricted by many different class I alleles, including HLA-B8,
B-14, A-2, A3.1, and A24 (7, 11, 12, 22). Within the CTL
epitope, a K597
R substitution has been shown to abrogate
CTL recognition, presumably by interfering with peptide-major
histocompatibility complex interactions (12). Many specimens
in the present study, ranging from 5% for subtype C to 33% for
subtype A, had a natural K597
R mutation. Whether this
mutation will result in abrogation of CTL recognition or emergence of
CTL escape mutants in these subjects remains to be determined.
The ectodomain within cluster II (ELDKWA) represents an epitope that
induces neutralizing antibody activity in humans with HIV-1 infection.
A human monoclonal antibody (MAb), 2F5, exhibits broad cross-clade
neutralization of primary isolates by binding to the ectodomain region,
resulting in an altered confirmation of the gp120-gp41 fusion domain as
well as the binding sites for the CD4 cell receptor (13, 16, 17,
20, 21). Variations in this ectodomain region, including
D673
N or E and K674
N, almost completely
abrogate the binding of MAb 2F5 (20). In the present study,
a K674
X substitution in 31 individuals naturally
infected with HIV-1 did not affect serologic detection; however, the
ability of the substitution to disrupt the neutralizing activity of
certain antibodies, such as MAb 2F5, remains to be determined.
N-glycosylated envelope proteins are required for full pathogenic
potential, and further evidence suggests that disruption of
glycosylation sites on gp41 could abrogate binding of the fusion peptide to the cell membrane (15). Although analysis of the glycosylation sites at positions 620 and 646 revealed a high degree of
variability within the second position of the cluster I glycosylation site, less than 5% of these sites exhibited substitutions capable of
abrogating glycosylation events.
A comprehensive analysis of the variations in the IDR of gp41 has shown
consistent minor variations. However, these minor substitutions in the
IDR did not have an impact on overall antibody recognition of
HIV-1-seropositive specimens in any of the FDA-licensed EIA kits. One
possibility is that antibodies produced against other structural
regions, such as p24, are sufficient to elicit a positive response in
the EIA kits. However, a strong immune response was detected against
the group M gp41 consensus peptide, suggesting that none of these
mutations has an impact on gp41-specific antibodies. Further, we
demonstrated that serum specimens from HIV-1 group M-infected
individuals also have cross-reactive antibodies that recognize a
homologous region not only in HIV-1 groups N and O but also in SIVcpz,
the SIV closely related to HIV-1 (6). Likewise, we have
recently shown that serum specimens from chimpanzees infected with SIV
(SIVcpzANT and SIVcpzUS) also reveal cross-reactivity with the HIV-1
group M consensus peptide (S. Masciotra et al., unpublished data). It
is interesting to note that gp41 sequences from HIV-1-infected but
seronegative cases (5, 25) were similar to the consensus
sequences, suggesting that a lack of antibody detection in these
specimens was not due to sequence variation in the gp41 region.
Overall, minimal variations appear to occur in the N-terminal region of
gp41. It is interesting to note that despite such conservation at the
protein level within this region, the nucleotide sequence analysis
permits phylogenetic clustering for identification of HIV-1 group M
subtypes (19). In conclusion, none of the observed substitutions among the group M (subtypes A to G)-infected individuals had an impact on antibody detection, since the specimens tested positive in both the commercially available FDA-licensed EIA kits and
the gp41 group M peptide-based EIA. However, we cannot exclude the
possibility that specimens with lower antibody titers may be missed by
these assays. While minor substitutions in the gp41 region did not
alter the antigenicity of HIV-1, any biological significance of the
observed amino acid substitutions within the N-terminal IDRs of gp41
remains to be determined.
 |
ACKNOWLEDGMENTS |
We thank J. S. McDougal, C. Schable, B. Parekh, and C. Pau
for critical review of the manuscript. We also thank N. Young and K. Limpakarnjanarat for providing some of the specimens tested and R. Moseley for editorial assistance.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: HIV Immunology
and Diagnostics Branch, DASTLR/NCID, Centers for Disease Control and Prevention, Mail Stop D12, 1600 Clifton Rd., Atlanta, GA 30333. Phone:
(404) 639-1036. Fax: (404) 639-2660. E-mail: rbl3{at}cdc.gov.
 |
REFERENCES |
| 1.
|
Binley, J. M.,
P. J. Klasse,
Y. Cao,
I. Jones,
M. Markowitz,
D. D. Ho, and J. P. Moore.
1997.
Differential regulation of the antibody responses to Gag and Env proteins of human immunodeficiency virus type 1.
J. Virol.
71:2799-2809[Abstract].
|
| 2.
|
Busch, M. P.,
L. L. Lee,
G. A. Satten,
D. R. Henrard,
H. Farzadegan,
K. E. Nelson,
S. Read,
R. Y. Dodd, and L. R. Peterson.
1995.
Time course of detection of viral and serologic markers preceding human immunodeficiency virus type 1 seroconversion: implications for screening of blood and tissue donors.
Transfusion
35:91-97[CrossRef][Medline].
|
| 3.
|
Centers for Disease Control and Prevention.
1996.
U.S. Public Health Service guidelines for testing and counseling blood and plasma donors for human immunodeficiency virus type 1 antigen.
Morbid. Mortal. Weekly Rep.
45:1-9[Medline].
|
| 4.
|
Cotropia, J.,
K. Ugen,
S. Kliks,
K. Broliden,
P. A. Broliden,
J. A. Hoxie,
V. Srikantan,
W. V. Williams, and D. B. Weiner.
1996.
A human monoclonal antibody to HIV-1 gp41 with neutralizing activity against diverse laboratory isolates.
J. Acquir. Immune Defic. Syndr.
12:221-232.
|
| 5.
|
Ellenberger, D. L.,
P. S. Sullivan,
J. Dorn,
C. Schable,
T. J. Spira,
T. M. Folks, and R. B. Lal.
1999.
Viral and immunologic examination of human immunodeficiency virus type 1-infected, persistently seronegative persons.
J. Infect. Dis.
180:1033-1042[CrossRef][Medline].
|
| 6.
|
Gao, F.,
E. Bailes,
D. L. Robertson,
Y. Chen,
C. M. Rodenburg,
S. F. Michael,
L. B. Cummins,
L. O. Arthur,
M. Peeters,
G. M. Shaw,
P. M. Sharp, and B. H. Hahn.
1999.
Origin of HIV-1 in the chimpanzee Pan troglodytes troglodytes.
Nature
397:546-441.
|
| 7.
|
Hammond, S. A.,
E. Obah,
P. Stanhope,
C. R. Monell,
M. Strand,
R. M. Robbins,
W. B. Bias,
R. W. Karr,
S. Koenig, and R. F. Siliciano.
1991.
Characterization of a conserved T cell epitope in HIV-1 gp41 recognized by vaccine-induced human cytolytic T cells.
J. Immunol.
146:1470-1477[Abstract].
|
| 8.
|
Horal, P.,
B. Svennerholm,
S. Jeansson,
L. Rymo,
W. W. Hall, and A. Vahlne.
1991.
Continuous epitopes of the human immunodeficiency virus type 1 (HIV-1) transmembrane glycoprotein and reactivity of human sera to synthetic peptides representing various HIV-1 isolates.
J. Virol.
65:2718-2723[Abstract/Free Full Text].
|
| 9.
|
Hu, D.,
T. J. Dondero,
T. D. Mastro, and H. D. Gayle.
1998.
Global and molecular epidemiology of HIV, p. 27-40.
In
G. P. Wonnser (ed.), AIDS and other manifestations of HIV infection. Lipponcott-Raven Publishers, Philadelphia, Pa.
|
| 10.
|
Hunter, E.
1997.
gp41, a multifunctional protein involved in HIV entry and pathogenesis, p. III55-III73.
In
B. Korber, B. H. Hahn, B. Foley, J. Mellors, T. Leitner, G. Myers, F. McCutchan, and C. Kuiken (ed.), Human retrovirus and AIDS. Los Alamos National Laboratory, Los Alamos, N. Mex.
|
| 11.
|
Ikeda-Moore, Y.,
H. Tomiyama,
K. Miwa,
S. Oka,
A. Iwamoto,
Y. Kaneko, and M. Takiguchi.
1997.
Identification and characterization of multiple HLA-A24-restricted HIV-1 CTL epitopes: strong epitopes are derived from V regions of HIV-1.
J. Immunol.
159:6241-6252.
|
| 12.
|
Johnson, R. P.,
A. Trocha,
T. M. Buchanan, and B. D. Walker.
1992.
Identification of overlapping class I-restricted cytotoxic T cell epitopes in a conserved region of the human immunodeficiency virus type 1 envelope glycoprotein: definition of minimum epitopes and analysis of the effects of sequence variation.
J. Exp. Med.
175:961-971[Abstract/Free Full Text].
|
| 13.
|
Kessler, J. A.,
P. M. McKenna,
E. A. Emimi,
C. P. Chan,
M. D. Patel,
S. K. Gupta,
G. E. Mark,
C. F. Barbas,
D. R. Burton, and A. J. Conley.
1997.
Recombinant human monoclonal antibody IgG1b12 neutralizes diverse human immunodeficiency virus type 1 primary isolates.
AIDS Res. Hum. Retrovir.
13:575-582[Medline].
|
| 14.
|
Leitner, T.
1996.
Genetic subtypes of HIV-1, p. III28.
In
G. Myers, B. Korber, B. Foley, K.-T. Jeang, J. Mellors, and S. Wain-Hobson (ed.), Human retrovirus and AIDS: a compilation of nucleic acids and amino acid sequences. Los Alamos National Laboratory, Los Alamos, N. Mex.
|
| 15.
|
Montefiori, D. C.,
W. E. Robinson, Jr., and W. M. Mitchell.
1988.
Role of protein N-glycosylation in pathogenesis of human immunodeficiency virus type 1.
Proc. Natl. Acad. Sci. USA
85:9248-9252[Abstract/Free Full Text].
|
| 16.
|
Muster, T.,
F. Steindl,
M. Purtscher,
A. Trkola,
A. Klima,
G. Himmler,
G. Rüker, and H. Katinger.
1993.
A conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1.
J. Virol.
67:6642-6647[Abstract/Free Full Text].
|
| 17.
|
Neurath, A. R.,
N. Strick,
K. Lin, and S. Jiang.
1995.
Multifaceted consequences of anti-gp41 monoclonal antibody 2F5 binding to HIV type 1 virions.
AIDS Res. Hum. Retrovir.
11:687-696[Medline].
|
| 18.
|
Oldstone, M. B.,
A. Tishon,
H. Lewicki,
H. J. Kyson,
V. A. Feher,
N. Assa-Munt, and P. E. Wright.
1991.
Mapping the anatomy of the immunodominant domain of the human immunodeficiency virus gp41 transmembrane protein: peptide conformation analysis using monoclonal antibodies and proton nuclear magnetic resonance spectroscopy.
J. Virol.
65:1727-1734[Abstract/Free Full Text].
|
| 19.
|
Pieniazek, D.,
C. Yang, and R. B. Lal.
1998.
Phylogenetic analysis of gp41 envelope of HIV-1 group M, N, and O strains provides an alternate region for subtype determination, p. III112-III117.
In
B. Korber, B. H. Hahn, and B. Foley (ed.), Human retrovirus and AIDS. Los Alamos National Laboratory, Los Alamos, N. Mex.
|
| 20.
|
Poignard, P.,
P. J. Klasse, and Q. J. Sattentan.
1996.
Antibody neutralization of HIV-1.
Immunol. Today
17:239-246[CrossRef][Medline].
|
| 21.
|
Purtscher, M.,
A. Trkola,
A. Grassauer,
P. M. Schulz,
A. Klima,
S. Döpper,
G. Gruber,
A. Buchacher,
T. Muster, and H. Katinger.
1996.
Restricted antigenic variability of the epitope recognized by the neutralizing gp41 antibody 2F5.
AIDS
10:587-593[Medline].
|
| 22.
|
Rowland-Jons, S.,
R. Tan, and A. McMichael.
1997.
Role of cellular immunity in protection against HIV infection.
Adv. Immunol.
65:277-346[Medline].
|
| 23.
|
Rudolph, D. L., and R. B. Lal.
1993.
Discrimination of human T lymphotropic virus type-I and type-II infections by synthetic peptides comprising structural epitopes from the envelope glycoproteins.
Clin. Chem.
39:288-292[Abstract].
|
| 24.
|
Simon, F.,
P. Mauclère,
P. Roques,
I. Loussert-Ajaka,
M. C. Müller-Trutwin,
S. Saragosti,
M. C. Georges-Coubort,
F. Barré-Sinoussi, and F. Bru-Vézinet.
1998.
Identification of a new human immunodeficiency virus type 1 distinct from group M and group O.
Nat. Med.
4:1032-1037[CrossRef][Medline].
|
| 25.
|
Sullivan, P. S.,
C. Schable,
W. Koch,
A. N. Do,
T. Spira,
A. Lansky,
D. Ellenberger,
R. B. Lal,
C. Hyer,
R. Davis,
M. Marx,
S. Paul,
J. Kent,
R. Armor,
J. McFarland,
J. Lafontaine,
S. Mottice,
S. A. Cassol,
N. Michael, and the Seronegative AIDS Clinical Study Group.
1999.
Persistently negative HIV-1-antibody EIA screening results for patients with HIV-1 infection and AIDS: serologic, clinical, and virologic results.
AIDS
13:89-96[CrossRef][Medline].
|
| 26.
|
Xu, J.,
M. K. Gorny,
T. Palker,
S. Karwowska, and S. Zolla-Pazner.
1991.
Epitope mapping of two immunodominant domains of gp41, the transmembrane protein of human immunodeficiency virus type 1, using ten human monoclonal antibodies.
J. Virol.
65:4832-4838[Abstract/Free Full Text].
|
| 27.
|
Yang, C.,
D. Pieniazek,
S. M. Owen,
C. Fridlund,
J. Nkengasong,
T. D. Mastro,
M. A. Rayfield,
R. Downing,
B. Biryawaho,
A. Tanuri,
L. Zekeng,
G. van der Groen,
F. Gao, and R. B. Lal.
1999.
Detection of phylogenetically diverse human immunodeficiency virus type 1 groups M and O from plasma by using highly sensitive and specific generic primers.
J. Clin. Microbiol.
37:2581-2586[Abstract/Free Full Text].
|
Journal of Clinical Microbiology, February 2000, p. 773-780, Vol. 38, No. 2
0095-1137/00/$04.00+0
This article has been cited by other articles:
-
Zouhair, S., Roussin-Bretagne, S., Moreau, A., Brunet, S., Laperche, S., Maniez, M., Barin, F., Harzic, M.
(2006). Group O Human Immunodeficiency Virus Type 1 Infection That Escaped Detection in Two Immmunoassays. J. Clin. Microbiol.
44: 662-665
[Abstract]
[Full Text]
-
Xu, L., Pozniak, A., Wildfire, A., Stanfield-Oakley, S. A., Mosier, S. M., Ratcliffe, D., Workman, J., Joall, A., Myers, R., Smit, E., Cane, P. A., Greenberg, M. L., Pillay, D.
(2005). Emergence and Evolution of Enfuvirtide Resistance following Long-Term Therapy Involves Heptad Repeat 2 Mutations within gp41. Antimicrob. Agents Chemother.
49: 1113-1119
[Abstract]
[Full Text]
-
Gaudy, C., Moreau, A., Brunet, S., Descamps, J.-M., Deleplanque, P., Brand, D., Barin, F.
(2004). Subtype B Human Immunodeficiency Virus (HIV) Type 1 Mutant That Escapes Detection in a Fourth-Generation Immunoassay for HIV Infection. J. Clin. Microbiol.
42: 2847-2849
[Abstract]
[Full Text]
-
O'Connell, R. J., Merritt, T. M., Malia, J. A., VanCott, T. C., Dolan, M. J., Zahwa, H., Bradley, W. P., Branson, B. M., Michael, N. L., De Witt, C. C.
(2003). Performance of the OraQuick Rapid Antibody Test for Diagnosis of Human Immunodeficiency Virus Type 1 Infection in Patients with Various Levels of Exposure to Highly Active Antiretroviral Therapy. J. Clin. Microbiol.
41: 2153-2155
[Abstract]
[Full Text]
-
Koch, W. H., Sullivan, P. S., Roberts, C., Francis, K., Downing, R., Mastro, T. D., Nkengasong, J., Hu, D., Masciotra, S., Schable, C., Lal, R. B.
(2001). Evaluation of United States-Licensed Human Immunodeficiency Virus Immunoassays for Detection of Group M Viral Variants. J. Clin. Microbiol.
39: 1017-1020
[Abstract]
[Full Text]
-
Masciotra, S., Rudolph, D. L., van der Groen, G., Yang, C., Lal, R. B.
(2000). Serological Detection of Infection with Diverse Human and Simian Immunodeficiency Viruses Using Consensus env Peptides. CVI
7: 706-709
[Abstract]
[Full Text]