Table 3

Peptides that can be assigned to mass signals and the mutations that lead to peak shifts

m/zORFReference no. or type of confirmationaIEPsigBbPeptide sequencee
2,201PSMα4199.70fMAIVGTIIKIIKAIIDIFAK
2,289PSMα19.70fMGIIAGIIKVIKSLIEQFTGK
2,307PSMα210.00fMGIIAGIIKFIKGLIEKFTGK
2,636PSMα39.52fMEFVAKLFKFFKDLLGKFLGNN
2,685PSMα3fMEFVAKLFKFFKDLLGKFLGNY
3,007Delta-toxin208.19fMAQDIISTIGDLVKWIIDTVNKFTKK
3,037Delta-toxinfMAQDIISTISDLVKWIIDTVNKFTKK
3,875SA2420.1m9.60fMKKLAVILTLVGGLYFAFKKYQERVNQAPNIEY
3,891SA2420.1fMKKLAVILTLVGGLYYAFKKYQERVNQAPNIEY
4,306rpmJ (SAS078)k10.32MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG
4,511SAR1012k11.24fMRQFIKRIVKTILVGYVIKFIRNKLSGKSSHPTDNKHK
4,485cSAR1012fMRQFIKRTVKTILVGYVIKFIRNKLSGKSSHPTDNKHN
4,497dSAR1012fMRQFIKRIVKTILVGYVIKFIRNKLSGKSSHPTDNKHN
5,032graF (SAS030)5.05ySNENQNKKAAEKAKEVEEKLKDKKEEKTEDINQTKQDIQDTLN
5,032graF (SAS030)sSNENQNKKATEKAKEVEEKLKDKKEVKTEDINQTKQDIQDTLN
5,002graF (SAS030)sSNENQNKKAAEKAKEVEEKLKDKKEVKTEDINQTKQDIQDTLN
5,525SAS0495.07ySFMDKAKDAVEKFKNSDNEQVKNVKDKINEYTGSNNEEKKENEDKEK
5,507SAS049sSFIDKAKDAVEKFKNSDNEQVKNVKDKINEYTGSNNEEKKENEDKEK
5,551SAS049sSFMDKAKDAVEKFKNSDNEQVKNVKDKINEYTGLNNEEKKENEDKEK
5,539SAS049sSFMDKAKDAVEKFKNSDNEQVKNVKDKINEYTGSNNEEKKEKEDKEK
6,354rpmF (SAS033)10.05AVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK
6,412rpmF (SAS033)sAVPKRRTSKTRKNKRRTHFKISVPDMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK
6,423rpmD (SA2030)10.11AKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEEK
6,397rpmD (SA2030)sAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNAAIRGQINKVKHLVTVEEK
6,552SA14526.51yADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKATGKAKEVVENAKNKITDAIDKLKK
6,592SA1452sADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKVIGKAKEVVENAKNKITDAIDKLKK
6,580SA1452sADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKATGKAKEVVENAKNKITDAIDKLRK
6,568SA1452sADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKATGKAKEVVENAKNKITDSIDKLKK
6,613graC (SAS044)6.11PIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSDQ
6,627graC (SAS044)sPIVNVKLLEGRSDEQLKKLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSDQ
6,641graC (SAS044)sPIVNVKLLEGRSDEQLKNLVSEVTDVVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSDQ
3,825cgraC (SAS044)sPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRstop
6,889SA0772k5.16yADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKGNKGE
8,091rpmC (SA2039)k9.52MKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTVAREREIEQSKANQ
8,019rpmC (SA2039)sMKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTVARERGIEQSKANQ
8,061rpmC (SA2039)sMKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRAVRKTIARLKTVAREREIEQSKANQ
8,891rpsT (SA1414)k10.50ANIKSAIKRVKTTEKAEARNISQKSAMRTAVKNAKTAVSNNADNKNELVSLAVKLVDKAAQSNLIHSNKADRIKSQLMTANK
9,627hup (SA1305)k9.52MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK
10,105rpsP (SA1081)9.93AVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQKKAK
10,153rpsP (SA1081)sAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKWLNDGAKPTYTVHNILSKEGIMKKFDEQKKAK
  • a The identities of the peaks were confirmed by knockdown (k), sequencing of strains with peak shifts (s), or MALDI-TOF/TOF (m).

  • b Transcription of the peak is dependent on sigma factor B (y).

  • c The peptide variant was usually not observed.

  • d The peptide variant was sometimes observed.

  • e Boldface letters signify variant amino acids.